  | 
				Lonelygirl15 Forum to post messages about Bree and Danielbeast   
				 | 
			 
		 
		 
	
		| View previous topic :: View next topic   | 
	 
	
	
		| Author | 
		Message | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Tue Feb 27, 2007 1:22 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				 	  | Weepel wrote: | 	 		   	  | Luminous wrote: | 	 		  | TO FIND IT YOU WILL HAVE TO SHIFT YOUR PERSPECTIVE ON THE SEQUENCE THAT GOT YOU HERE  | 	  
 
It seems to me that the idea ist o take the DNA sequence that was decoded and then use that as a new coded message in a vigenere cipher (which is just a bunch of shifts http://en.wikipedia.org/wiki/Vigen%C3%A8re_cipher).  I think its just a matter of finding the key and applying it to: cgacatatgagcatggcgaccagcaccttcagtgcgcagtgtggcccggagcatcattacctggctgaa
 
cattcttctatttttaatggcgtcttcagccagcagcttaaaaacaaccttatctactttccctcctcctactttccctcctcccgcttgagggtaggccccatcccccccttt | 	  
 
 
I wish I understood what you are talking about    _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		blahblablee Lonely Fan
 
  Joined: 31 Dec 2006 Posts: 237 Location: FacilityJ
  | 
		
			
				 Posted: Tue Feb 27, 2007 2:44 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				| Um, just wanted to post about the "Stops". I don't see them being significant since they've been on every telegram forever...  So I just suggest not looking into it too much but I mean if something comes up go for it =) | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		McPackage Casual Observer
  
  Joined: 22 Jan 2007 Posts: 76 Location: California
  | 
		
			
				 Posted: Tue Feb 27, 2007 2:49 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				Yeah, Walter probably doesn't know how to use e-mail, so he has to send telegrams.    | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Tue Feb 27, 2007 3:25 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				Just so everyone knows, kayokosaeki is working on a frame by frame breakdown of the Proper Introductions video. She said she'll have it posted sometime late tonight.
 
 
 
Yay kayokosaeki! Thank you in advance!   _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Tue Feb 27, 2007 4:12 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				I haven't solved it, but I tried somethings that may give someone else an idea, so I'm sharing what I did:
 
 
Using this tool: http://rumkin.com/tools/cipher/vigenere.php
 
 
I input the "Sequence that got us here" (which was decoded by TOSG) as the message text to be decoded:
 
 
cgacatatgagcatggcgaccagcaccttcagtgcgcagtgtggcccggagcatcattacctggctgaacattcttctatttttaatggcgtcttcagccagcagcttaaaaacaaccttatctactttccctcctcctactttccctcctcccgcttgagggtaggccccatcccccccttt
 
 
I reversed it, and input the reversed sequence as the passphrase:
 
 
tttccccccctaccccggatgggagttcgccctcctccctttcatcctcctccctttcatctattccaacaaaaattcgacgaccgacttctgcggtaatttttatcttcttacaagtcggtccattactacgaggcccggtgtgacgcgtgacttccacgaccagcggtacgagtatacagc
 
 
The result I got was this:
 
 
jnhayryreyncyreewaajwuacujjrnayeaeanayeanaegjaaneynayrjharajaagnjreaaaattctajrutrntryutenjeawrnwhgcjhnjhgjrahyhhaaaawjrnuaarajatrjcancwnaaruwanawcanawawcanjrrgyageraaewwjcyncwjcjcatnr
 
 
which, while still jibberish, looks strangely related to the text from the circle stamp on Walter's telegram:
 
 
wnhwyry 
 
aaanay 
 
aagwehjjh 
 
nauaj 
 
 
Still working . . . . . . .    _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		TOSG Devoted Fan
  
  Joined: 14 Sep 2006 Posts: 651
 
  | 
		
			
				 Posted: Tue Feb 27, 2007 6:32 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				Perhaps the text in the circled stamp is the passphrase, and the DNA sequence (or the protein sequence or some portion or variant thereof) is the text to be decoded?
 
 
That said, I tried a few things (protein sequence, DNA sequence, reverse complement, etc...), and couldn't get anything to work. | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		kayokosaeki Lonely Fan
  
  Joined: 14 Dec 2006 Posts: 238 Location: usa, tristate area
  | 
		
			
				 Posted: Tue Feb 27, 2007 9:27 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				 	  | Luminous wrote: | 	 		  
 
 
I realize I should give you more specific information, to eliminate any confusion. The video we need analyzed is by user WalterDW on Youtube, and it is called "A Proper Introduction" Here's the link -
 
 
http://youtube.com/watch?v=SrU0Im9LjNY
 
 
We have discovered there are some marks that look like letters roughly stenciled on a chalkboard. So far we have found several A's and several S's. We need to know exactly how many there are, and if there are any others we have missed. Frame count may also be important.
 
 
The other thing we have noticed are some dark grey rectangles that mimic film frames going by. This may or may not be important, but if there is a way to count them, we would like to.
 
 
And then of course anything else you see that might be a clue.
 
 
Again, thank you so much!  I'm excited to see what you find   | 	  
 
 
ok, so there are two frames in which a partial "A" appears superimposed over a 36.  
 
 
 
 
 
 
 
then the 36 shifts to appear twice in one frame....
 
 
 
 
 
...before a superimposed "S" appears for two frames
 
 
 
 
 
 
 
then don't forget the "GY" which shifts once after 20 frames to be on the right side
 
 
 
 
 
 
 
then 36 appears again for only 4 frames, just like before only the blacks are darker (i won't post a freeze frame. its just as i say) then 77 appears, shifting once like this
 
 
 
 
 
and then 16 frames later the "S" appears again partially
 
 
 
 
 
the very end is a fade in and out of the sequence "A" "S" "A" in the same stencil lettering, but i'm going to save my photo bandwidth and not post those freeze frames. its exactly as luminos previously posted
 
 
as for the dark grey rectangles that mimic the old film reel, i really see no hidden meaning in them. its just an effect. there's practically one in every frame in the beginning portion (none in the middle or end), but i counted them anyway for you: 47
 
 
hope that helps. let me know if you need anything else    [/img] _________________ gotta love a girl with her own theme music.
 
 
"do you have a gun?"
 
"no. but i do have a lawyer. and we're done." | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Tue Feb 27, 2007 9:54 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				Thank you so much Kayokosaeki. This helps alot. I'm sure it means something. Now to figure out what? _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Weepel Suspiciously Absent
 
  Joined: 30 Jan 2007 Posts: 16
 
  | 
		
			
				 Posted: Tue Feb 27, 2007 10:04 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				 	  | TOSG wrote: | 	 		  | Perhaps the text in the circled stamp is the passphrase, and the DNA sequence . . . is the text to be decoded?  | 	  
 
 
When you do this, decode the dna sequence with the stamp letters you get:
 
gttgccctgatcctgagctttttcgctxgveicicgcngvgtakyvtxzngiakgnmxcletggptiaawepmtkmptgtkxgmeccigcggcvtcukyvrxvngitkenteclcaccgtctcneymkkvpczctxpvxclvttcpcvccngyvxtmggggxkgtkileccagceccwgymkk
 
 
which looks like more dna and more jibberish. | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Tue Feb 27, 2007 10:33 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				Here is a rather longish recap of where we are and how we got here:
 
 
Walterdw released a new video titled A Proper "Introduction"
 
We have learned he has left clues in this video that will ultimately lead us to his true identity. The name WalterDW is a shield he created to protect himself until we earn is trust.
 
 
At the beginning of the video, numbers and letters flash by the screen 
 
 
 
Theresascraps discovered these lead to http://tinyurl.com/36gy77, which redirected us to craigs list where Walter had posted a string of
 
base64 code which translated to
 
 
We knew the Soviets had them. They were at least ten years ahead of 
 
us. The Kirov and Sverdlovsk facilities were producing results before we 
 
had even begun. It wasn't hard for some half-witted military drones to 
 
weaponize the standards, although I do feel for the whitecoats. Lovett 
 
wanted something more from us, the intellectual elite. We were to 
 
produce a more discrete product. 
 
 
gaagagcaagcgccatgttgaagccatcattaccattcacatccctcttattcctgcagctgcccctgctggg 
 
agtggggctgaacacgacaattctgacgcccaatgggaatgaagacggatccaccacagctgtcgagtg 
 
ggaaatctgggactggagggggctggtgagaagggtggctgtgggaaggggccgtacagagatctggt 
 
gcctgccactggccattacaatcatgtgggcagaattgaaaagtggagtgggaagggcaagggggagg 
 
gttccctgcctcacgctacttcttctttctttcttgtttgtttgtttctttctttcttttgaggcagggtctcactatgttg 
 
cctaggctggtctcaaacggatcctcctggctcgactctagtgatcctcctgcctcagcctttcaaagcacca 
 
ggattacagacatgagccaccgtgcttggcctcctccttctgaccatcatttctctttccctccctgccttcatttt 
 
ctccccaatctagatttcttcctgaccactatgcccactgactccctcagtgtttccactctgcccctcccagga 
 
tccgaggttcagtgttttgtgttcaatgtcgacatatgagcatggcgaccagcaccttcagtgcgcagtgtgg 
 
cccggagcatcattacctggctgaacattcttctatttttaatggcgtcttcagccagcagcttaaaaacaac 
 
cttatctactttccctcctcctactttccctcctcccgcttgagggtaggccccatccccccctttcgagtacatg 
 
gatccgaattgcacttggaacagcagctctgagccccagcctaccaacctcactctgcattattggtatgag 
 
aagggacgagggggaggggatgaagaagaggtgggttggatcagagaccaagagagagggtagca 
 
agtctcccaggtaccccactgttttctcctggggtaagtcataagtcggttgaggggagatgaggctaggct 
 
ctggatatctgcagtacccagattggccccactgttcctcttccttccatcgaacctttctcctctaggtacaag 
 
aactcggataatgaggatcctaaagtccagaagtgcagccactatctattctctgaagaaatcacttctggc 
 
tgtcagttgcaaaaaaaggagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacc 
 
caggagacaggccacacagatgctaaaactgcagaatctgggtaatttggaaagaaagggtcaagag 
 
accagggatactgtgggacattggagtctacagagtagtgttcttttatcataagggtacatgggcagaaa 
 
agaggaggtaggggatcatgatgggaagggaggaggtattaggggcactaccttcaggatcctgacttg 
 
tctaggccagggtcgagaatgaccacatatgcacacatatctccagtgatcccctgggctccagagaacct 
 
aacacttcacaaactgagtgaatcccggatccagctagaactgaactggaacaacagattcttgaaccac 
 
tgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgtgagtgactagggacgtg 
 
aatgtagcagctaaggccaagaa 
 
 
1(+8 ) 1 3(+7) 2(-1) 3(-6) 1(+4) 1(+3) 2(+3) 5 1 6 1 1(-1) 4 7 2 6 9 9 1 5 4 1 1 2 3 1 2 4 4(+1) 5(-1) 5 3 9 9 1 3 1(+1) 1 4 1(+2) 1 2 2 2 2 1 2 2 2 2 2 2(+1) 4 1 7 6 1 6 7 1
 
 
TOSG decoded this to find a hidden message:
 
 
"I had new hope after meeting her. I had my reels back. Three Three R Five Nine P" 
 
 
which lead to another tinyurl
 
 
Leads to http://tinyurl.com/33R59P 
 
 
TOSG's recap on how he did it:
 
 
Okay, here's my explanation. I wish that I had some brilliant, razor-like solution, but I'm afraid that I just used logic and persistence, with a few guiding principles. 
 
 
1) Looking at a BLAST (http://130.14.29.110/BLAST/ ; look at "nblast") alignment of the sequence, I saw that there were three large regions of human DNA, and two regions of DNA sequence that did not match with any known DNA source. 
 
 
2) So, I hypothesized, as before, that the unmatched DNA was likely where the message was encoded (as Walter could have free reign to encode any message he liked there, rather than being constrained to a given sequence of human DNA). 
 
 
3) Thus, I manually removed most of the regions that had homology with the human DNA, so I could focus on the (in my estimation) important part of the sequence. 
 
 
4) So, I made a restriction map of this sequence (on the NEBCutter 2.0 program), showing all the restriction enzymes that cut the sequence. 
 
 
5) I noticed that BamHI was a double-cutter of this sequence (BamHI is a commonly used enzyme, so that tipped me off), and removed the rest of two of the human DNA regions. So, I cut the DNA with that. 
 
 
6) I then looked at this fragment in NEBCutter, again. 
 
 
7) Given the clue that TaqI might be used (see my previous post), I searched for that, and found that it cut three times. 
 
 
 I counted up that Walter had given instructions for decoding 61 letters, so I looked for a DNA fragment that was 61*3 = 183 bases long. 
 
 
9) Awesome! I found that two of the TaqI cut sites combined to leave behind a 183-base pair sequence! 
 
 
10) I put this sequence into a protein translator, and then grinded away at decoding the letters, according to the same principles as last time. 
 
 
So, there you have it! Probably not the most elegant way to do it, but it worked, and pretty fast. 
 
 
For the curious, the DNA sequence is: cgacatatgagcatggcgaccagcaccttcagtgcgcagtgtggcccggagcatcattacctggctgaa 
 
cattcttctatttttaatggcgtcttcagccagcagcttaaaaacaaccttatctactttccctcctcctactttccctcctcccgcttgagggtaggccccatcccccccttt 
 
 
And the protein sequence is: R H M S M A T S T F S A Q C G P E H H Y L A E H S S I F N G V F S Q Q L K N N L I Y F P S S Y F P S S R L R V G P I P P F
 
 
this second tinyurl lead us to a telegram from WD
 
 
 
MY NEW ACQUAINTANCES 
 
I FEAR THAT I HAVE NO CHOICE BUT TO TRUST YOU STOP
 
IT LOOKS LIKE YOU SOMEHOW MANAGED TO PROPERLY CUT THE DNA STOP
 
I AM SURPRISED STOP
 
THE FIRST CUT MAY BE THE DEEPEST, BUT THE SECOND ENZYME WAS MORE SIGNIFICANT STOP
 
I SUPPOSE THAT IT IS TIME THAT I LET YOU KNOW MY FULL IDENTITY STOP
 
TO FIND IT YOU WILL HAVE TO SHIFT YOUR PERSPECTIVE ON THE SEQUENCE THAT GOT YOU HERE STOP
 
 
With these letters stamped on the paper
 
 
wnhwyry 
 
aaanay 
 
aagwehjjh 
 
nauaj 
 
 
 
The paper the telegram was written on had a number 11226 or possibly 11228 cut off at the top of the paper. Originally I thought they might mean something, but now my thought is they were just random arbitrary numbers on the paper, although I suppose it's possible he could have used them as a key to encode something. But probably not. We have learned we have a vigenere cipher which requires letters for the passphrase, not numbers.
 
 
We have taken so long in decoding this and finding Walters true identity, that he gave us a hint through a change in his profile "You act as if I gave you a chiffre indéchiffrable" (French for 'the unbreakable cipher') and which is understood to be a Vigenère cipher.
 
 
In order to uncover the true Identity of WalterDW, we must decipher this Vigenère cipher he left us in the telegram. 
 
 
Hope this makes sense and is helpful to everyone   _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess
  Last edited by Luminous on Tue Feb 27, 2007 10:42 pm; edited 1 time in total | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Tue Feb 27, 2007 10:35 pm    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				 	  | blahblablee wrote: | 	 		  | Um, just wanted to post about the "Stops". I don't see them being significant since they've been on every telegram forever...  So I just suggest not looking into it too much but I mean if something comes up go for it =) | 	  
 
 
Thanks. It sounds like you must know something about decoding DNA. _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		janesalteredstates Devoted Fan
  
  Joined: 12 Jan 2007 Posts: 763 Location: Jenlight's head
  | 
		 | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		trainer101 Moderator Manager
  
  Joined: 20 Sep 2006 Posts: 2671 Location: Wasting away again ILLUMINATIVILLE...
  | 
		
			
				 Posted: Wed Feb 28, 2007 1:57 am    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				
 
Ah, sharky's site is back up. It was down for a bit. Unfiction.com has some useful tools also. _________________ It's STILL all connected... | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		mellie3204 Enthusiastic Fan
  
  Joined: 07 Oct 2006 Posts: 251 Location: Melbourne, Australia
  | 
		
			
				 Posted: Wed Feb 28, 2007 2:30 am    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				Wow guys.  Truely awesome work.
 
 
Luminous, that recap is excellent, any chance it can be copied/moved to the start of the thread??
 
 
Again, awesome guys. 
 
 
              | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		Luminous Thor's Hammer
  
  Joined: 26 Nov 2006 Posts: 1359 Location: Facility J
  | 
		
			
				 Posted: Wed Feb 28, 2007 2:38 am    Post subject:  | 
				     | 
			 
			
				
  | 
			 
			
				 	  | mellie3204 wrote: | 	 		  Wow guys.  Truely awesome work.
 
 
Luminous, that recap is excellent, any chance it can be copied/moved to the start of the thread??
 
 
Again, awesome guys. 
 
 
              | 	  
 
 
Thank you.     Need a moderator to handle that request - maybe Trainer? That might help breathe some new life into this. I fear we are failing Walter, and the old fart is 87. We've gotta handle this before we loose him    _________________ You made a wise choice, Bree.
 
There's no place like home.
 
Click to watch: The Ice Princess | 
			 
		  | 
	 
	
		| Back to top | 
		 | 
	 
	
		  | 
	 
	
		 | 
	 
 
  
	 
	    
	   | 
	
You cannot post new topics in this forum You cannot reply to topics in this forum You cannot edit your posts in this forum You cannot delete your posts in this forum You cannot vote in polls in this forum
  | 
   
 
  
Powered by phpBB © 2001, 2005 phpBB Group
  
		 |